DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr30B

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:135 Identity:45/135 - (33%)
Similarity:60/135 - (44%) Gaps:24/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVT 135
            ||:.|...::.....|.| ..|.|.:.|.|.||||.|.|:|:..:..|.|.|.|.:.||..|.|.
  Fly    13 LASAVWAIELQAEPDYGP-VAYEFQWSVNDPHTGDIKSQKESRKDDKVEGVYELIDSDGYRRIVQ 76

  Fly   136 YTADKVNGFNAVVEK-------------KGVAAVAIAKPALAVAAVPAITKIGYASAPG-----L 182
            |.||..|||.|:|::             |.:.|..|..|.|.||.:     :.||:...     |
  Fly    77 YKADDHNGFEAIVQREPTDIKIPLPEPPKKLLAAKILTPVLPVAPL-----VHYAAPKAIIKQEL 136

  Fly   183 SLGGY 187
            |.|.|
  Fly   137 SAGNY 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 23/51 (45%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.