DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr5C

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster


Alignment Length:118 Identity:56/118 - (47%)
Similarity:70/118 - (59%) Gaps:4/118 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AAPAISYAAPAISYAPKVLAAPVAVAKVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGV 117
            |||..:|||||.:...|.:|.|| :||  ..|.|||:|||.::|.|.|..:||||.|.|.....|
  Fly    28 AAPVATYAAPAPAAVLKTVAQPV-LAK--ADEEYDPHPQYKYAYDVQDAISGDSKSQVEERDGDV 89

  Fly   118 VHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKGVAAVAIAKPALAVAAVPA 170
            |.|.|||.:.||..|.|.||||.:|||||||.::.:.. .:.|....||.|.|
  Fly    90 VRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVK-TVVKTVAPVAPVYA 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 25/51 (49%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.