DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ac and Cpr31A

DIOPT Version :9

Sequence 1:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A / 2768918 FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster


Alignment Length:172 Identity:74/172 - (43%)
Similarity:97/172 - (56%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IPIDP-----YGLSAPGLTYAAPKLLAAPAISYAAPKLLAAPAISYAAPAISYAPKVLAAPVAVA 78
            :|..|     |.|..|.:...||..||.|..:.....|.|||.:  |||.:.   .|.|||..:.
  Fly    66 VPAAPVYTRSYALPTPVVKAVAPAPLALPVAAPVVKTLAAAPVV--AAPVVK---TVAAAPAVLK 125

  Fly    79 KVAVAEPYDPNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNG 143
            :|.:    :.:|:|.|||||.|..|||.|.|.||...|.|.||||:.:.||..|.||||||.:||
  Fly   126 QVEL----ESSPRYDFSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDING 186

  Fly   144 FNAVVEKKG-VAAVAIAKPALAVAAVPAITKIGYASAPGLSL 184
            |||||:::. |||.|:|.|.::|:| ||...:..:|||..||
  Fly   187 FNAVVQREPVVAARAVAAPVVSVSA-PAPVPVHISSAPVASL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 30/51 (59%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.