powered by:
Protein Alignment Cpr64Ab and CPR146
DIOPT Version :9
Sequence 1: | NP_647873.2 |
Gene: | Cpr64Ab / 38509 |
FlyBaseID: | FBgn0035511 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024667097.1 |
Gene: | CPR146 / 5668384 |
VectorBaseID: | AGAP012466 |
Length: | 153 |
Species: | Anopheles gambiae |
Alignment Length: | 66 |
Identity: | 28/66 - (42%) |
Similarity: | 35/66 - (53%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 NTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAV 97
|...:|...:.|.|.|.|..|.:..|.:.|.||||.:|.|.|...||..:.|.||||..||:||.
Mosquito 64 NHHHEPGMPFDFQYKVNDIETQNDYSHKAVSDGDVTRGEYRVQLPDGRTQVVRYTADWKNGYNAE 128
Fly 98 V 98
|
Mosquito 129 V 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.