DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and CPR5

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_001238481.1 Gene:CPR5 / 4577352 VectorBaseID:AGAP001668 Length:246 Species:Anopheles gambiae


Alignment Length:114 Identity:64/114 - (56%)
Similarity:78/114 - (68%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALIAAIECALLPAAVPVG----VPLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSY 72
            ||:||....:..||.|:.    .....|.|.:|||:|:|.:.||||||||||||.|.||||:|||
Mosquito    32 ALVAAPVAKVAYAAAPIAKVAYAAQPEEYDANPQYSFSYGISDALTGDSKSQQESRSGDVVQGSY 96

  Fly    73 SVVDADGSLRTVFYTADPINGFNAVVQRGPVPVAARPLV--APVAAPIL 119
            ||||.||:.|||.|||||.|||||||.|  .|:||:.:|  ||||..::
Mosquito    97 SVVDPDGTKRTVEYTADPHNGFNAVVHR--EPLAAKTIVAAAPVATKVI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 38/51 (75%)
CPR5XP_001238481.1 Chitin_bind_4 66..118 CDD:278791 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.