DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and Ccp84Af

DIOPT Version :10

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:139 Identity:68/139 - (48%)
Similarity:80/139 - (57%) Gaps:37/139 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALIAAIECALLP--------------AAVPVGV----PLNT----EVDPHPQYAFAYNVQDALTG 54
            |||:|....:||              |..||.|    |:.|    |.||||||.|||:|||:|:|
  Fly    10 ALISAASAGVLPVQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHPQYKFAYDVQDSLSG 74

  Fly    55 DSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQR-------------GPVPVA 106
            |||||.|.||||||.|.||::|:||..|.|.||:||:|||||||.|             .||.||
  Fly    75 DSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDHVKTVVKTVAPVAVA 139

  Fly   107 ARPLVAPVA 115
            |.|:  |||
  Fly   140 AAPI--PVA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 34/51 (67%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 34/51 (67%)

Return to query results.
Submit another query.