DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and Ccp84Ag

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:116 Identity:65/116 - (56%)
Similarity:81/116 - (69%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KITLICCALIAAIECALLPAAVPV-GVPLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVV 68
            |.|::..|.||.....::|||.|: .|....|.||||||.:.|:|:||::||||:|.|.|:||||
  Fly     4 KFTILFAACIAVASAGIIPAAAPLAAVAQVEEYDPHPQYTYGYDVKDAISGDSKTQVETREGDVV 68

  Fly    69 KGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPV--PVAARPLVAPVAAP 117
            :|.||:.||||..|.|.|||||||||||||:|.|:  .|||.| .|.||||
  Fly    69 QGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAP-AAVVAAP 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 32/51 (63%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.