DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and Cpr64Ad

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_647875.1 Gene:Cpr64Ad / 38511 FlyBaseID:FBgn0035513 Length:247 Species:Drosophila melanogaster


Alignment Length:102 Identity:66/102 - (64%)
Similarity:76/102 - (74%) Gaps:8/102 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PAAVPVGVPLNTE-VDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFY 86
            |.|.||..|:.|| ||.||||.|||:|||.||||||:|:|.||||||:||||:::.|||.|.|.|
  Fly   126 PLAAPVAAPIATEIVDAHPQYKFAYDVQDTLTGDSKTQEETRDGDVVRGSYSLIEPDGSRRIVSY 190

  Fly    87 TADPINGFNAVVQRGPVPVAARPLVAP-----VAAPI 118
            .||.|||||||||: .||||..| |||     ||||:
  Fly   191 YADSINGFNAVVQK-DVPVAVAP-VAPVLAKTVAAPV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 35/51 (69%)
Cpr64AdNP_647875.1 Chitin_bind_4 146..198 CDD:306811 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.