DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and Cpr64Aa

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster


Alignment Length:139 Identity:64/139 - (46%)
Similarity:84/139 - (60%) Gaps:27/139 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KITLICCALIAAIECALLPA---AVP----------VGVPLNTEV------DPHPQYAFAYNVQD 50
            |:.|:..||:|.....::|.   |:|          |..||..:|      ||:|||.|:|:|.|
  Fly     4 KLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHD 68

  Fly    51 ALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPVPVAARPLVAPVA 115
            ..|||.|||||.|.||||:|:||:::|||:.|.|.|||||::||||||:|....|.|   |||||
  Fly    69 GSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVVKA---VAPVA 130

  Fly   116 -----APIL 119
                 ||:|
  Fly   131 KVLAPAPLL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 31/51 (61%)
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.