DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and Cpr47Ed

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:126 Identity:34/126 - (26%)
Similarity:51/126 - (40%) Gaps:22/126 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALIKITLICCALI--AAIECALLPAAVPVGVPLNTEVDPHPQYAFAYNVQDA--------LTGD 55
            |..:.:.|..|.|:  ...||..:...||: :...||......|.|::...|.        ::.|
  Fly     1 MFALLLILTGCQLLWSCPAECTSINVPVPI-LKSVTEQLSSGSYLFSFESADGTYREELGIVSSD 64

  Fly    56 SKSQQEVRDGDV-VKGSYSVVDADGSLRTVFYTADPINGF---NAVVQRGPV--PVAARPL 110
            ||:.    |.|: |.|.|..::..|....|.||||. |||   ...:.:|..  |:...||
  Fly    65 SKTS----DDDLEVSGIYRYINDWGQEVEVRYTADK-NGFLPHVRYISKGEAYKPIRIEPL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 18/60 (30%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:278791 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.