DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and Cpr30B

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:123 Identity:47/123 - (38%)
Similarity:64/123 - (52%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KITLICCALIAAIECALLPAAVPVGVPLNTEVDPHP-QYAFAYNVQDALTGDSKSQQEVRDGDVV 68
            |:|.:.|..:|:...|         :.|..|.|..| .|.|.::|.|..|||.|||:|.|..|.|
  Fly     4 KVTYLLCLCLASAVWA---------IELQAEPDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKV 59

  Fly    69 KGSYSVVDADGSLRTVFYTADPINGFNAVVQRGP----VPVAARP---LVAPVAAPIL 119
            :|.|.::|:||..|.|.|.||..|||.|:|||.|    :|:...|   |.|.:..|:|
  Fly    60 EGVYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPLPEPPKKLLAAKILTPVL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 25/51 (49%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.