powered by:
Protein Alignment Cpr64Ab and AgaP_AGAP012875
DIOPT Version :9
Sequence 1: | NP_647873.2 |
Gene: | Cpr64Ab / 38509 |
FlyBaseID: | FBgn0035511 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_561509.5 |
Gene: | AgaP_AGAP012875 / 3292651 |
VectorBaseID: | AGAP012875 |
Length: | 98 |
Species: | Anopheles gambiae |
Alignment Length: | 44 |
Identity: | 13/44 - (29%) |
Similarity: | 19/44 - (43%) |
Gaps: | 8/44 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 ALIAAIECALLPAAVPVGVPLNTEVDPHPQYAFAYNVQDALTGD 55
|::..|....:..:|....|.| |.|:|:|.|..|||
Mosquito 62 AIVKTIAQPTIIKSVEHHAPAN--------YEFSYSVHDEHTGD 97
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cpr64Ab | NP_647873.2 |
Chitin_bind_4 |
42..94 |
CDD:278791 |
8/14 (57%) |
AgaP_AGAP012875 | XP_561509.5 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.