DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and CPR1

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_551141.1 Gene:CPR1 / 3290497 VectorBaseID:AGAP001664 Length:204 Species:Anopheles gambiae


Alignment Length:130 Identity:65/130 - (50%)
Similarity:79/130 - (60%) Gaps:19/130 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LICCALIAAIECALLPA--AVPVG----VPLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGD 66
            ::..|.:|.:..|..||  |.||.    .....|.|.:|.|:|:|.:.||||||||||||.|.||
Mosquito    33 VVAAAPVAKVAYAAAPAVVAAPVAKVAYAAQPEEYDANPHYSFSYGISDALTGDSKSQQESRSGD 97

  Fly    67 VVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGPV---------PVAARPLVA----PVAAPI 118
            ||:|||||||.||:.|||.|||||.|||||||.|.|:         |||.:.:||    ..|||:
Mosquito    98 VVQGSYSVVDPDGTKRTVEYTADPHNGFNAVVHREPLAAKTIVAAAPVATKTIVAQPAVAYAAPV 162

  Fly   119  118
            Mosquito   163  162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 38/51 (75%)
CPR1XP_551141.1 Chitin_bind_4 73..125 CDD:278791 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.