powered by:
Protein Alignment Cpr64Ab and CPR63
DIOPT Version :9
Sequence 1: | NP_647873.2 |
Gene: | Cpr64Ab / 38509 |
FlyBaseID: | FBgn0035511 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_565333.2 |
Gene: | CPR63 / 3290255 |
VectorBaseID: | AGAP006866 |
Length: | 182 |
Species: | Anopheles gambiae |
Alignment Length: | 62 |
Identity: | 36/62 - (58%) |
Similarity: | 47/62 - (75%) |
Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 HPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQR 100
:|:|.:.|.||||.|||.|||.|:||||||||.|::.||||:.|.|.|::|..:||.|.|:|
Mosquito 85 YPKYKYDYGVQDAHTGDHKSQWEIRDGDVVKGGYTLYDADGTKRVVEYSSDKHHGFQAHVKR 146
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.