powered by:
Protein Alignment Cpr64Ab and Cpr11A
DIOPT Version :9
Sequence 1: | NP_647873.2 |
Gene: | Cpr64Ab / 38509 |
FlyBaseID: | FBgn0035511 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_572803.1 |
Gene: | Cpr11A / 32198 |
FlyBaseID: | FBgn0030394 |
Length: | 270 |
Species: | Drosophila melanogaster |
Alignment Length: | 62 |
Identity: | 22/62 - (35%) |
Similarity: | 30/62 - (48%) |
Gaps: | 11/62 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 VVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRG-----PVPVAA---RPLVAPVAAPILG 120
||.||||...|||......||||.. |::.:.:.. |.|:|: |..|.| :.:||
Fly 98 VVSGSYSFTGADGKRYKTRYTADEF-GYHPITELDLDIPEPQPLASAGQRQTVDP--SSLLG 156
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.