DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and Itsn1

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_006522994.1 Gene:Itsn1 / 16443 MGIID:1338069 Length:1743 Species:Mus musculus


Alignment Length:31 Identity:10/31 - (32%)
Similarity:17/31 - (54%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VPLNTEVDPHPQYAFAYNVQDALTGDSKSQQ 60
            |.|.|::||..|:....::.|.||...:.:|
Mouse  1231 VKLTTDMDPSQQWCSDLHLLDMLTPTERKRQ 1261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 4/19 (21%)
Itsn1XP_006522994.1 EH 39..132 CDD:197477
PLN02983 <155..226 CDD:215533
EH 238..333 CDD:197477
PTZ00121 <355..739 CDD:173412
SH3 766..825 CDD:388381
INTAP 825..939 CDD:374674
SH3_Intersectin1_2 939..990 CDD:212922
SH3_Intersectin1_3 1028..1079 CDD:212924
SH3_Intersectin1_4 1096..1160 CDD:212926
SH3_Intersectin1_5 1180..1233 CDD:212928 1/1 (100%)
RhoGEF 1260..1443 CDD:238091 1/2 (50%)
PH_13 1462..1615 CDD:374702
C2_Intersectin 1604..1738 CDD:176021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.