DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and CPR110

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_319711.4 Gene:CPR110 / 1279926 VectorBaseID:AGAP008960 Length:188 Species:Anopheles gambiae


Alignment Length:138 Identity:57/138 - (41%)
Similarity:77/138 - (55%) Gaps:22/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIKITLICCALIAAIECALLPAAVPVGVPLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDV 67
            :.|:.::..|:...:....:..|.|..:....|.|.||||:|:|:|||:||||:|.|.|.|||||
Mosquito     1 MFKVFVVLAAVAVGVNSVAIGVAAPATLVKTEEYDAHPQYSFSYDVQDSLTGDNKQQHETRDGDV 65

  Fly    68 VKGSYSVVDADGSLRTVFYTADPINGFNAVVQRG----------------------PVPVAARPL 110
            |:|.||:|:.||:.|||.|||||:|||||||.:.                      .|.||..|.
Mosquito    66 VQGQYSLVEPDGTRRTVDYTADPVNGFNAVVSKSADAAVVKTVAAAPVAHVAYHAPTVAVAHAPA 130

  Fly   111 VAPVAAPI 118
            ||...||:
Mosquito   131 VAVAHAPV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 34/51 (67%)
CPR110XP_319711.4 Chitin_bind_4 40..92 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.