DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and CPR80

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_318998.3 Gene:CPR80 / 1279297 VectorBaseID:AGAP009878 Length:250 Species:Anopheles gambiae


Alignment Length:110 Identity:34/110 - (30%)
Similarity:50/110 - (45%) Gaps:23/110 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PAAVPVGVPL---NTEVDPHPQYAFAYNVQDALTGDSKSQQ----------EVRDGDVVKGSYSV 74
            |.|:...||:   :.:|.....|::||.     |||.:.||          :..:...|:||||.
Mosquito   111 PNAIRPFVPITSYSNDVSYDGSYSYAYT-----TGDGQQQQAQGYLKNAGRKDLEAQAVQGSYSY 170

  Fly    75 VDADGSLRTVFYTADPINGFNA----VVQRGPVPVAARPLVAPVA 115
            ...:|.|.||.|.||. |||.|    :....|:|.|.:..:|.:|
Mosquito   171 TSPEGQLITVTYIADE-NGFRAEGAHLPTPPPIPEAIQKSLALIA 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 21/61 (34%)
CPR80XP_318998.3 Chitin_bind_4 133..189 CDD:278791 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.