DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and CPR116

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_311664.4 Gene:CPR116 / 1272758 VectorBaseID:AGAP003378 Length:128 Species:Anopheles gambiae


Alignment Length:131 Identity:77/131 - (58%)
Similarity:93/131 - (70%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IKITLICCALIAAIEC-----ALLPAAVPVGVPLNTEVDPHPQYAFAYNVQDALTGDSKSQQEVR 63
            :|..:...:|.||:..     |::|.|..|.|  :|..||.|||.:|||||||||||||||||.|
Mosquito     1 MKFFVFVASLSAAVAMFGAHGAVVPVAPAVAV--STNYDPLPQYTYAYNVQDALTGDSKSQQETR 63

  Fly    64 DGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQRGP------VPVAARPLV---APVAAPIL 119
            |||:|:||||:|:.||:||||||||||:|||||||||||      |||||.|.:   ||||. :|
Mosquito    64 DGDIVRGSYSLVEPDGTLRTVFYTADPVNGFNAVVQRGPLVPKAVVPVAAGPAILAPAPVAR-VL 127

  Fly   120 G 120
            |
Mosquito   128 G 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 41/51 (80%)
CPR116XP_311664.4 Chitin_bind_4 42..94 CDD:278791 41/51 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I13597
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44574
Inparanoid 1 1.050 134 1.000 Inparanoid score I6986
OMA 1 1.010 - - QHG26322
OrthoDB 1 1.010 - - D133302at33392
OrthoFinder 1 1.000 - - FOG0014357
OrthoInspector 1 1.000 - - oto107321
Panther 1 1.100 - - LDO PTHR12236
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X15326
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.