DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and CPR55

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_308909.2 Gene:CPR55 / 1270230 VectorBaseID:AGAP006837 Length:152 Species:Anopheles gambiae


Alignment Length:112 Identity:45/112 - (40%)
Similarity:62/112 - (55%) Gaps:20/112 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLICCALIAAIECALLPAAVPVGVPLNT-----EVD-------------PHPQYAFAYNVQDALT 53
            |:||  |:|.:..|.:..:.....|...     |||             .:|:|.|.|.|:|.||
Mosquito     6 TIIC--LVAFVHGAHIKQSAVKHKPRQASYQLEEVDAGKELIEESQDYYAYPKYQFEYGVKDPLT 68

  Fly    54 GDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQR 100
            ||.|||.|:||||:|||||::.:.||:.|.|.|.||..|||.|:|::
Mosquito    69 GDHKSQWEMRDGDIVKGSYTLDEPDGTQRIVEYRADDRNGFEAIVKK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 30/51 (59%)
CPR55XP_308909.2 Chitin_bind_4 57..109 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.