DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Ab and AgaP_AGAP012866

DIOPT Version :9

Sequence 1:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_306539.4 Gene:AgaP_AGAP012866 / 1267981 VectorBaseID:AGAP012866 Length:195 Species:Anopheles gambiae


Alignment Length:115 Identity:60/115 - (52%)
Similarity:72/115 - (62%) Gaps:20/115 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PAAVPVGVPL--------NTEVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADG 79
            ||...|..||        ..|.|.:|||:::|.|.||:|||:|:|||.|.||||.||||:|:.||
Mosquito    66 PAVAKVAAPLAVAKVAAPYAEYDANPQYSYSYAVADAVTGDNKNQQESRSGDVVTGSYSLVEPDG 130

  Fly    80 SLRTVFYTADPINGFNAVVQRGPV------PVA------ARPLVAPVAAP 117
            :.|||.|.|||||||||||.|.|:      |:|      |.|.||.||||
Mosquito   131 TRRTVEYNADPINGFNAVVHREPLAVKAVAPIAKYAAPLAYPAVAKVAAP 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:278791 33/51 (65%)
AgaP_AGAP012866XP_306539.4 Chitin_bind_4 93..145 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.