DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:134 Identity:39/134 - (29%)
Similarity:57/134 - (42%) Gaps:37/134 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHD 68
            |.::|..||.||:         ||.|| ...|.:.:..:.:     |||      .:.:.::..|
  Fly     2 KFLIVFVALFAVA---------LAAPA-AEEPTIVRSESDV-----GPE------SFKYDWETSD 45

  Fly    69 GST-------GDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVVKAV 126
            |..       .|:.::.|..|   |.|:|..|..||....|.|.||. :||    :.|||.: .|
  Fly    46 GQAAQAVGQLNDIGTENEAIS---VSGSYRFIADDGQTYQVNYIADK-NGF----QPEGAHL-PV 101

  Fly   127 APVA 130
            ||||
  Fly   102 APVA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 15/58 (26%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 15/58 (26%)

Return to query results.
Submit another query.