DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:218 Identity:97/218 - (44%)
Similarity:117/218 - (53%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALP-AYPSYPALA-------KVAAPLVAKVAGPEPYDPN 57
            ||.|.:..| |.|||:||...|   :|.| .|.:.||:|       .||..:|.|.|  |.|||:
  Fly     1 MAFKFVFAL-AFVAVASAGYAP---IAAPQVYHAAPAVATYAHAPVAVAQKVVVKAA--EEYDPH 59

  Fly    58 PQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE--- 119
            |||.|||.|.|..|||.|.|.|.|.||||:|.||||:|||.:|.|:|||||::||||||.||   
  Fly    60 PQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREPLV 124

  Fly   120 -----GAVVKAV-APVAKVLAPAPLLHASPLVAKVPA-----YGPALAPAYPALAHGYGPA---- 169
                 ..|||.| ||||:..|||...:|:|.|.|..|     ..||:......:||...||    
  Fly   125 KAVAVAPVVKTVAAPVAQYAAPAVAHYAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAYAT 189

  Fly   170 -LAPAYGPALPKLALPALSPLGY 191
             .||.:..|....|.||.:...|
  Fly   190 YAAPTHYAAPAHYAAPAATYTSY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 32/51 (63%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 32/51 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50625
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.