DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Ccp84Af

DIOPT Version :10

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:152 Identity:76/152 - (50%)
Similarity:94/152 - (61%) Gaps:17/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVA-APLVAKVAGP------EPYDPNP 58
            ||.|...|| ||::.:||.|:|    ....|.:.||:|..| ||:....|.|      |.|||:|
  Fly     1 MAFKFFAVL-ALISAASAGVLP----VQQVYHAAPAVATYAQAPVAVAHAQPVLTKATEEYDPHP 60

  Fly    59 QYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRR----- 118
            ||.|:|||.|..:||.|||.|.|.||||.|.||||::||.:|||:||:|||:||||||.|     
  Fly    61 QYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNAVVNRVPLDH 125

  Fly   119 EGAVVKAVAPVAKVLAPAPLLH 140
            ...|||.|||||...||.|:.:
  Fly   126 VKTVVKTVAPVAVAAAPIPVAY 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 32/51 (63%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 32/51 (63%)

Return to query results.
Submit another query.