DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Ccp84Ag

DIOPT Version :9

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:206 Identity:97/206 - (47%)
Similarity:118/206 - (57%) Gaps:37/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGLALPAYPSYPALAKVAAPLVAKVAGPEPYDPNPQYTFSYD 65
            ||.|..::.:|.:||:||.::|                 .||||.| ||..|.|||:||||:.||
  Fly     1 MAFKFTILFAACIAVASAGIIP-----------------AAAPLAA-VAQVEEYDPHPQYTYGYD 47

  Fly    66 VHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE----------G 120
            |.|..:||.|:|.|||.||||||.|||.:|||.||||:|||||::|||||||||          .
  Fly    48 VKDAISGDSKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGFNAVVRREPLVAAVAAAPA 112

  Fly   121 AVVKAVAPVAKVLAPAPLLHASPL-----VAKVP-AYGPALAP-AYPALAHGYGPALAPAYGPAL 178
            |||.|.|||.:....||::.|:||     .|..| ||..|.|| ||.|.|.....|...|.|||:
  Fly   113 AVVAAPAPVVRAAVAAPVVRAAPLTTTYAAAPAPLAYAAAPAPLAYAAPAPVVKAAPLVAAGPAI 177

  Fly   179 PK--LALPALS 187
            .|  .|.|.:|
  Fly   178 VKTQFASPLIS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 34/51 (67%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:278791 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.