DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Cpr78Ca

DIOPT Version :10

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:127 Identity:25/127 - (19%)
Similarity:49/127 - (38%) Gaps:34/127 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 GEALKYLSIKYGVFHAIY------SYWKNKREIWQKPILRRLQPPPPVNDTNPYNVFRPREKAHR 230
            |:.::|...:......:|      |..:.::.|.:.|||..::|                 |..:
  Fly    16 GKYVRYTPEQVEALERLYHDCPKPSSIRRQQLIRECPILSNIEP-----------------KQIK 63

  Fly   231 LHARRMQQRENNAQSFEKLRQVRRNLDQAKTILEALIKREEKKRDFMASEVSLQRIQLKYKN 292
            :..:..:.||...:...:|:.|.|.|    |.:..|:..|   .|.:..:||    ||.::|
  Fly    64 VWFQNRRCREKQRKEASRLQAVNRKL----TAMNKLLMEE---NDRLQKQVS----QLVHEN 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 13/66 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.