DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Cpr76Ba

DIOPT Version :9

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:209 Identity:63/209 - (30%)
Similarity:88/209 - (42%) Gaps:67/209 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQKLILVLSALVAVSSAVVVP--------GPGLALPAYPSYPALAK---------VAAPLV--- 45
            ||.:|.::..||:.|::|..:|        |.|.::..:...|...:         |..|..   
  Fly     1 MAHQLSILCCALLGVAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKAHSW 65

  Fly    46 -----------AKVAGPEPY-------DP--NPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAY 90
                       |.||..:.:       :|  :|:|.|:|.|.|..|||:|.|.|||.||.|:|.|
  Fly    66 GTVQDHHHQQWAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGY 130

  Fly    91 SLIEADGTRRIVEYTADPVHGFNAVVRREGAVVKAVAPVAKVLAPAPLLHASPLVAKVPAYGPAL 155
            ::.||||..||||||||..:||.|.|:..|                   |||.| ....:||   
  Fly   131 TMKEADGRTRIVEYTADSHNGFQATVKHVG-------------------HASHL-EHSHSYG--- 172

  Fly   156 APAYPALAHGYGPA 169
                ....||:|.|
  Fly   173 ----QQYGHGHGHA 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 30/51 (59%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.