DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:141 Identity:28/141 - (19%)
Similarity:47/141 - (33%) Gaps:41/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRREGAVVK 124
            |.:.::..:|    :..|::...|....|:......:|....:.||||. :||    :.:|..:.
  Fly    46 YNYQFETSNG----IAQQEQGVGGYYASGSSQYYTPEGQLIQLTYTADE-NGF----QPQGEHLP 101

  Fly   125 AVAPVAKVLAPAPLLHASPLVAKVP--------------------AYGPALAPAY--PALAHGYG 167
            ...|:     |..:|.:.......|                    ::|......|  ||     |
  Fly   102 TPHPI-----PEAILKSLEYNRNHPEEDGEYEHHDHHHDHHEHHQSHGQEQGKQYLQPA-----G 156

  Fly   168 PALAPAYGPAL 178
            ..||||..|.|
  Fly   157 ALLAPASSPVL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 10/51 (20%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 10/51 (20%)

Return to query results.
Submit another query.