DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Lcp65Ad

DIOPT Version :10

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_477278.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:99 Identity:27/99 - (27%)
Similarity:46/99 - (46%) Gaps:12/99 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AYPSYPALAKVAAPLVAKVAGPEPYDPN--PQ-YTFSYDVHDGST----GDVKSQQETRSGDVVQ 87
            |:....|.:..|.|.:.:.|....:|.:  |: |.|:.:..||.:    |.:|.........||:
  Fly     8 AFTCILACSLAAPPAIQQDAQVLRFDSDVLPEGYKFAVETSDGKSHQEEGQLKDVGTDHEAIVVR 72

  Fly    88 GAYSLIEADGTRRIVEYTADPVHGFNAVVRREGA 121
            |:|:.:..||....::|.||. :||    :.|||
  Fly    73 GSYAYVGDDGQTYSIQYLADE-NGF----QPEGA 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 15/55 (27%)
Lcp65AdNP_477278.1 Chitin_bind_4 41..96 CDD:459790 15/55 (27%)

Return to query results.
Submit another query.