DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Cpr62Ba

DIOPT Version :9

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001137868.1 Gene:Cpr62Ba / 38239 FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster


Alignment Length:92 Identity:28/92 - (30%)
Similarity:40/92 - (43%) Gaps:18/92 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVH-GFNAVVR------ 117
            |:..|.:.|.::......:|.|.||.|.|:||.:|..|..|.|.|.....: ||.|||.      
  Fly    45 YSHQYHISDVASRVHILHREQRHGDYVSGSYSHLEPSGHIRSVHYEVRGANRGFKAVVEQRTGNS 109

  Fly   118 --------REGAVVKAVA---PVAKVL 133
                    |....::|:|   |||.|:
  Fly   110 RVHQTLEFRSRQPIRALAIAEPVAFVI 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 16/52 (31%)
Cpr62BaNP_001137868.1 Chitin_bind_4 45..89 CDD:278791 15/43 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.