DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Cpr57A

DIOPT Version :10

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster


Alignment Length:134 Identity:43/134 - (32%)
Similarity:55/134 - (41%) Gaps:29/134 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LAKVAAPLVAKVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGD---VVQGAYSLIEADGT 98
            |..|||..|:.:..|||..|...|.|||..  |.......:|.|...|   |::||:|.::....
  Fly     9 LLAVAAADVSHLVTPEPKVPASPYVFSYQA--GRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQ 71

  Fly    99 RRIVEYTADPVHGFN--------------AVVRREGAVVKAVA-------PVAKVLAPAPLLHAS 142
            .|.|:|.||. |||:              |..:|..|....:|       |....||.||  |||
  Fly    72 VRTVQYVADE-HGFHPQLSHKLEDSAAVQAAKQRHFAAYNRIAQEHANHTPGQVALANAP--HAS 133

  Fly   143 PLVA 146
            ..||
  Fly   134 AAVA 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 18/54 (33%)
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 18/54 (33%)

Return to query results.
Submit another query.