DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:61 Identity:22/61 - (36%)
Similarity:31/61 - (50%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YTFSYD-----VHDGSTGDVKSQQETRSGDVVQ-GAYSLIEADGTRRIVEYTADPVHGFNA 114
            |...|:     :|: .||.:|......:|.:|| |.||....:||...|:||||. :||.|
  Fly    66 YKTEYETGNSIIHE-ETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADE-NGFRA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 19/57 (33%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 19/57 (33%)

Return to query results.
Submit another query.