DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Cpr23B

DIOPT Version :9

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:159 Identity:61/159 - (38%)
Similarity:82/159 - (51%) Gaps:32/159 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVLSALVAVSSAVVVPGPGLALPA------------------------YPSYPALAKVAAPLVA 46
            :|..:|..|.:.:|::|.|   ||.                        ..|.|.   |.:.::.
  Fly    86 LLQNAASAANAESVLLPSP---LPVLRHEQNSEVVSSTQQQQEQQTVQHQQSEPL---VVSSVLR 144

  Fly    47 KVAGPEPYDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHG 111
            :...||.:.| ..|:|:|.|:|.||||:|...|||.|.||:|.||||:.||.:|.|.||||.|||
  Fly   145 QHQEPEVFPP-ASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHG 208

  Fly   112 FNAVVRREGAVVKA-VAPVAKVLAPAPLL 139
            |||||.|....:|| |.|||:|..|.|.:
  Fly   209 FNAVVNRVPYALKAVVVPVAQVAQPTPFV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 31/51 (61%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.