DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and Cpr5C

DIOPT Version :9

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster


Alignment Length:144 Identity:76/144 - (52%)
Similarity:97/144 - (67%) Gaps:13/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQKLILVLSALVAVSSAVVVPGPGL--ALP----AYPSYPALAK-VAAPLVAKVAGPEPYDPNP 58
            ||.|.:.:| ||:|.:||.|:|...|  |.|    |.|:..|:.| ||.|::||  ..|.|||:|
  Fly     1 MAFKFVALL-ALIAAASAGVLPAGQLYHAAPVATYAAPAPAAVLKTVAQPVLAK--ADEEYDPHP 62

  Fly    59 QYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRRE---G 120
            ||.::|||.|..:||.|||.|.|.||||:|.|||:::||.:|.|:|||||::||||||.||   .
  Fly    63 QYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNREPLVK 127

  Fly   121 AVVKAVAPVAKVLA 134
            .|||.|||||.|.|
  Fly   128 TVVKTVAPVAPVYA 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:278791 29/51 (57%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D147941at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50625
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.