DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr64Aa and LOC1276643

DIOPT Version :10

Sequence 1:NP_647872.1 Gene:Cpr64Aa / 38508 FlyBaseID:FBgn0035510 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_316012.3 Gene:LOC1276643 / 1276643 VectorBaseID:AGAMI1_007835 Length:173 Species:Anopheles gambiae


Alignment Length:67 Identity:37/67 - (55%)
Similarity:44/67 - (65%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YDPNPQYTFSYDVHDGSTGDVKSQQETRSGDVVQGAYSLIEADGTRRIVEYTADPVHGFNAVVRR 118
            |...|:|.|.|.|.|..|||.|||.|.|.||||:|.|:|.|.||:.|||:|.||..:||.|||:.
Mosquito    68 YYAYPKYKFEYGVKDYHTGDHKSQWEVRDGDVVKGEYTLDEPDGSTRIVKYHADSKNGFEAVVKN 132

  Fly   119 EG 120
            .|
Mosquito   133 IG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr64AaNP_647872.1 Chitin_bind_4 60..112 CDD:459790 29/51 (57%)
LOC1276643XP_316012.3 None

Return to query results.
Submit another query.