DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43367 and Wdr81

DIOPT Version :9

Sequence 1:NP_001189048.2 Gene:CG43367 / 38505 FlyBaseID:FBgn0263110 Length:2754 Species:Drosophila melanogaster
Sequence 2:XP_038941944.1 Gene:Wdr81 / 303312 RGDID:1311334 Length:1944 Species:Rattus norvegicus


Alignment Length:316 Identity:97/316 - (30%)
Similarity:140/316 - (44%) Gaps:74/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  2056 GSGR--SPAELLRASGLTQRWINREISNFEYLMYLNTIAGRSYNDLSQYPVFPWILADYTSDVLD 2118
            |.||  .|.......||...|::..:|||.|||.||.:|||...|.:.:||.||        |:|
  Rat   328 GEGRPGCPTCQKELRGLVLDWVHGRVSNFYYLMQLNRLAGRRQGDPNYHPVLPW--------VVD 384

  Fly  2119 LTDPKS-FRDLSKPIGCINPKNEAEVRGKYDSFEDP-----SGAIPKFHYGTHYSNSAGVLHYLL 2177
            .|.|.. ||||.|....:| |.:.::...|:.....     :|:....|...|.|:....:.|.:
  Rat   385 FTTPYGRFRDLRKSKFRLN-KGDKQLDFTYEMTRQAFVAGGAGSGEPLHVPHHISDVLSDITYYV 448

  Fly  2178 ---RVEPFTSL--HIDLQSGRFDVADRQFHSIP------QTWKLLMDNPNDVKELIPEFFYFPEF 2231
               |..|.:.|  |:.        |..:.|..|      |||     .|:   |.||||:..|..
  Rat   449 YKARRTPRSVLCGHVR--------AQWEPHEYPATMERMQTW-----TPD---ECIPEFYTDPSI 497

  Fly  2232 LKNMNKFDLGHLQITKEKVDDVILPAWATTPEEFIAIHRRALESEYVSQHLHHWIDLIFGYKQKG 2296
            ..:::           ..:.|:.:|||.::.:||:..||..|||..|||.|||||||.||||.:|
  Rat   498 FCSIH-----------PDMPDLDVPAWCSSNQEFVTAHRALLESWEVSQDLHHWIDLTFGYKLQG 551

  Fly  2297 PKAAEALNVFYYCSYEGAVDLDKITNPVEREAVEGMINNFGQVPSQLLREPHPRRL 2352
            .:|.:..||..:.       :|..|:          :.::|.|  ||..:|||:||
  Rat   552 KEAVKEKNVCLHL-------VDAHTH----------LTSYGVV--QLFDQPHPQRL 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43367NP_001189048.2 LamG 643..752 CDD:304605
DUF4704 906..1162 CDD:292415
DUF4800 1650..1899 CDD:292675
PH_BEACH 1952..2046 CDD:275391
Beach 2072..2351 CDD:280327 89/295 (30%)
WD40 <2428..2734 CDD:225201
WD40 repeat 2465..2503 CDD:293791
WD40 2468..2687 CDD:295369
WD40 repeat 2509..2580 CDD:293791
WD40 repeat 2585..2621 CDD:293791
Wdr81XP_038941944.1 Beach 347..587 CDD:100117 89/294 (30%)
WD40 1644..1942 CDD:421866
WD40 repeat 1655..1698 CDD:293791
WD40 repeat 1703..1737 CDD:293791
WD40 repeat 1746..1782 CDD:293791
WD40 repeat 1792..1825 CDD:293791
WD40 repeat 1834..1867 CDD:293791
WD40 repeat 1874..1896 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1786
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101142at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.