DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tipE and Teh2

DIOPT Version :9

Sequence 1:NP_523920.1 Gene:tipE / 38504 FlyBaseID:FBgn0003710 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_001163345.1 Gene:Teh2 / 38502 FlyBaseID:FBgn0035505 Length:313 Species:Drosophila melanogaster


Alignment Length:302 Identity:85/302 - (28%)
Similarity:120/302 - (39%) Gaps:108/302 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DEQDKRTGKEKLLFYTTAFFILLGT---FSLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDT 64
            :|.:..|..||..|||:   :.|||   .|:|.||||:|||::||.:||...::.||..|...|.
  Fly    73 EEIEMDTLLEKAKFYTS---VCLGTTAILSVFTFLFLIPFVVDPAISTIIADYDPVPVTCIVIDH 134

  Fly    65 EIYYGAKNCSWSSCREGCTKDIYTCTQIRVNYRLNLYNFTDEFNFTEYHINLKEAERILPPVKRT 129
            ....|.|||||||||||||..:..|.|:.|||        ....|:|:..|.::.:.:       
  Fly   135 IYAEGIKNCSWSSCREGCTSSLTKCHQLFVNY--------TRIPFSEWERNPRDLDTV------- 184

  Fly   130 DRYERALRSDYEYDNLGGGTGLDIDLGAGRMEQLNFGDADGSNGYLIEDSEDTRGLSASGTLISD 194
                   ..|..|..                             :||                  
  Fly   185 -------NWDVSYTK-----------------------------FLI------------------ 195

  Fly   195 ERRPFDEISELNEGLMGNRSMYYYVGARLFPNVKGCGYPPMLNCTIWLKRY--TKIGMKFPCYYS 257
                                           |.:||||||..||:|:.::|  :.||..|||:||
  Fly   196 -------------------------------NSEGCGYPPTTNCSIFARQYGFSHIGEPFPCFYS 229

  Fly   258 KVDPSLVISDLDYWQNTLNLVYSMAIPIPSFIISVIYLTYAY 299
            :..|.:||....:..|..:|:.|:.||...|.||:..|:|.|
  Fly   230 RAYPEVVIGRYSWENNLYHLILSLIIPNVLFAISIGVLSYWY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tipENP_523920.1 TipE 1..452 CDD:293577 85/302 (28%)
Teh2NP_001163345.1 TipE 73..>271 CDD:293577 84/300 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJ08
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394377at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.