DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tipE and Teh4

DIOPT Version :9

Sequence 1:NP_523920.1 Gene:tipE / 38504 FlyBaseID:FBgn0003710 Length:452 Species:Drosophila melanogaster
Sequence 2:NP_647866.2 Gene:Teh4 / 38501 FlyBaseID:FBgn0035504 Length:524 Species:Drosophila melanogaster


Alignment Length:513 Identity:108/513 - (21%)
Similarity:166/513 - (32%) Gaps:167/513 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EQDKRTGKEKLLFYTTAFFILLGTFSLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDTEIYY 68
            |||.|..:...|...|.      ..|..:.::|...:..|:.......||..|.:|:|.|.::  
  Fly    13 EQDARICRAICLCQLTM------VLSCVSIVYLSVAIYSPSLKAFKSGFELDPVMCQTVDRQM-- 69

  Fly    69 GAKNCSWSSCREGC-TKDIYTCTQI-----------------RVN---------YRLNLYNFTD- 105
             ..||.|:||.|.| ||....|.||                 ||.         .|||.:|..: 
  Fly    70 -PNNCPWASCGEWCLTKTSGFCPQIHSIVRRNGTDIQLNNCTRVTNTSCAMIDLSRLNKFNCNNG 133

  Fly   106 --------EFNFTEYHI-NLKE--------------------------------AERILPPVKRT 129
                    .||.:..|. |:.|                                ..:|..|.. .
  Fly   134 TACNNIRGVFNCSNGHCKNMSEFFLCHHKADGLTVNSQKDNTKLNGFFECHGVHCTKIKKPFS-C 197

  Fly   130 DRYERALRSD------YEYDNLGGGTGLDIDLGAGRMEQLNFGDADGS-NGYLIE---------- 177
            |||...:.:.      ...|||         :.|.....:.|..|.|| :|..||          
  Fly   198 DRYCSKITTTNVNTLIMHEDNL---------IAADCENAVAFNQARGSEHGVRIEPFEFWKEDDG 253

  Fly   178 -------------DSEDTRGLSASGTLISDERRP-----FDEISELNEG-----------LMGNR 213
                         |:..|.....:|||:..:..|     |.:...:.|.           |....
  Fly   254 NLLTNCATVTRESDNRITATDCINGTLLEHDTLPAPFMNFTQFWAIYENSTRSVDPEQRYLPNQA 318

  Fly   214 SMYYYVGARLFPNVKGCGYPPMLNCTIWLKRYTKIG------MKFPCYYSK-VDPSLVISDLDYW 271
            ::..|...:||.|::||.......|..::.||...|      .::.|||:| .:...|::..|..
  Fly   319 NLTIYSWKKLFINLEGCVNTLRGECKDFVARYGNDGDNNTAQSRYQCYYNKDSNVEFVVARYDLD 383

  Fly   272 QNTLNLVYSMAIPIPSFIISVIYLTYAYFKIY-------------NEDEETAPL-----DKNAED 318
            :....|:.|:.:||..|:||.|.|......:.             ::.:...|.     :|..:.
  Fly   384 KVYRELLVSLIVPIVLFVISSISLCIITKSVKVGDDAKMRCVCAGDDSDNDGPFGPGLANKQQDQ 448

  Fly   319 M-DIDDIDAVD----DSDGAVLADNVAGSQIINMDSTTNDSCLEGVLPNGGPGMTASI 371
            | |.|| |.||    ..||..|:|:  |..:.|.:...:...|..:.|.|..|.:..|
  Fly   449 MYDTDD-DVVDLEHQAVDGQELSDH--GLPLDNQELIGSTKSLIPISPVGESGTSDQI 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tipENP_523920.1 TipE 1..452 CDD:293577 108/513 (21%)
Teh4NP_647866.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.