DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-c and Atp6v0e2

DIOPT Version :9

Sequence 1:NP_647868.1 Gene:VhaM9.7-c / 38503 FlyBaseID:FBgn0028664 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001334093.1 Gene:Atp6v0e2 / 76252 MGIID:1923502 Length:112 Species:Mus musculus


Alignment Length:63 Identity:19/63 - (30%)
Similarity:28/63 - (44%) Gaps:13/63 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWLCCYLAQLNPLLGPKLNG 67
            |.::.||.||..:...||....|.|:..::..:.:.|||       |||      ||.|.:.|
Mouse     8 LPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAV-------CCY------LLCPAVKG 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-cNP_647868.1 ATP_synt_H 6..64 CDD:283211 16/57 (28%)
Atp6v0e2NP_001334093.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842280
Domainoid 1 1.000 79 1.000 Domainoid score I8637
eggNOG 1 0.900 - - E1_KOG3500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5178
Isobase 1 0.950 - 0 Normalized mean entropy S2878
OMA 1 1.010 - - QHG49180
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - mtm8760
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.