DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-c and atpv0e2

DIOPT Version :9

Sequence 1:NP_647868.1 Gene:VhaM9.7-c / 38503 FlyBaseID:FBgn0028664 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001166106.1 Gene:atpv0e2 / 553767 ZFINID:ZDB-GENE-050522-135 Length:81 Species:Danio rerio


Alignment Length:73 Identity:30/73 - (41%)
Similarity:39/73 - (53%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWLCCYLAQLNPLLGPKLNGNT 69
            |.::.||..|..|....|.|..|.|:..::....:||||.|:||||...|||.|||.||:|...|
Zfish     8 LPMIGFTTLWGLVGIVAPFLVPKGPNRGVIITSLVLTAVCCYLFWLVAILAQANPLFGPQLKNET 72

  Fly    70 IRIIASSW 77
            |..:...|
Zfish    73 IWYLRYYW 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-cNP_647868.1 ATP_synt_H 6..64 CDD:283211 24/57 (42%)
atpv0e2NP_001166106.1 ATP_synt_H 9..67 CDD:283211 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586683
Domainoid 1 1.000 77 1.000 Domainoid score I8771
eggNOG 1 0.900 - - E1_KOG3500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5178
OMA 1 1.010 - - QHG49180
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - otm26584
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - O PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.