DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-c and atp6v0e1

DIOPT Version :9

Sequence 1:NP_647868.1 Gene:VhaM9.7-c / 38503 FlyBaseID:FBgn0028664 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001006038.2 Gene:atp6v0e1 / 450017 ZFINID:ZDB-GENE-041010-133 Length:81 Species:Danio rerio


Alignment Length:73 Identity:27/73 - (36%)
Similarity:38/73 - (52%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWLCCYLAQLNPLLGPKLNGNT 69
            :.|...|:.|..|....|....|..:..::..:.:||||.|:||||...|:|||||.||.|..:|
Zfish     8 IAIAVMTLLWGLVGGVIPWFIPKGANRGVIVTMLVLTAVCCYLFWLIAILSQLNPLFGPVLKNDT 72

  Fly    70 IRIIASSW 77
            |..:...|
Zfish    73 IWYLYYHW 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-cNP_647868.1 ATP_synt_H 6..64 CDD:283211 22/57 (39%)
atp6v0e1NP_001006038.2 ATP_synt_H 10..67 CDD:310236 22/56 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586679
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.