powered by:
Protein Alignment VhaM9.7-c and atp6v0e1
DIOPT Version :9
Sequence 1: | NP_647868.1 |
Gene: | VhaM9.7-c / 38503 |
FlyBaseID: | FBgn0028664 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006038.2 |
Gene: | atp6v0e1 / 450017 |
ZFINID: | ZDB-GENE-041010-133 |
Length: | 81 |
Species: | Danio rerio |
Alignment Length: | 73 |
Identity: | 27/73 - (36%) |
Similarity: | 38/73 - (52%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWLCCYLAQLNPLLGPKLNGNT 69
:.|...|:.|..|....|....|..:..::..:.:||||.|:||||...|:|||||.||.|..:|
Zfish 8 IAIAVMTLLWGLVGGVIPWFIPKGANRGVIVTMLVLTAVCCYLFWLIAILSQLNPLFGPVLKNDT 72
Fly 70 IRIIASSW 77
|..:...|
Zfish 73 IWYLYYHW 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170586679 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1613627at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.