DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-c and vma9

DIOPT Version :9

Sequence 1:NP_647868.1 Gene:VhaM9.7-c / 38503 FlyBaseID:FBgn0028664 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001343007.1 Gene:vma9 / 3361294 PomBaseID:SPBC1685.16 Length:67 Species:Schizosaccharomyces pombe


Alignment Length:61 Identity:19/61 - (31%)
Similarity:28/61 - (45%) Gaps:3/61 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFLTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWLCCYLAQLNPLLGP 63
            |.|.:...|...:.|:.|   :..|..:....:...:||...|:|.|...|||||:||..|
pombe     5 VVLLVGLLTALMSVVSYY---VSPKGNNTSTWQMSLILTFSCCYLLWAITYLAQLHPLEAP 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-cNP_647868.1 ATP_synt_H 6..64 CDD:283211 17/58 (29%)
vma9NP_001343007.1 ATP_synt_H 14..62 CDD:310236 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I3641
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - O PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.