powered by:
Protein Alignment VhaM9.7-c and vma9
DIOPT Version :9
Sequence 1: | NP_647868.1 |
Gene: | VhaM9.7-c / 38503 |
FlyBaseID: | FBgn0028664 |
Length: | 84 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001343007.1 |
Gene: | vma9 / 3361294 |
PomBaseID: | SPBC1685.16 |
Length: | 67 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 61 |
Identity: | 19/61 - (31%) |
Similarity: | 28/61 - (45%) |
Gaps: | 3/61 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 VFLTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWLCCYLAQLNPLLGP 63
|.|.:...|...:.|:.| :..|..:....:...:||...|:|.|...|||||:||..|
pombe 5 VVLLVGLLTALMSVVSYY---VSPKGNNTSTWQMSLILTFSCCYLLWAITYLAQLHPLEAP 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
43 |
1.000 |
Domainoid score |
I3641 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001872 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102348 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12263 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2893 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.940 |
|
Return to query results.
Submit another query.