Sequence 1: | NP_647868.1 | Gene: | VhaM9.7-c / 38503 | FlyBaseID: | FBgn0028664 | Length: | 84 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276919.2 | Gene: | ATP6V0E2 / 155066 | HGNCID: | 21723 | Length: | 187 | Species: | Homo sapiens |
Alignment Length: | 66 | Identity: | 30/66 - (45%) |
---|---|---|---|
Similarity: | 39/66 - (59%) | Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 LTIVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWLCCYLAQLNPLLGPKLNGNT 69
Fly 70 I 70 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
VhaM9.7-c | NP_647868.1 | ATP_synt_H | 6..64 | CDD:283211 | 25/57 (44%) |
ATP6V0E2 | NP_001276919.2 | ATP_synt_H | 9..67 | CDD:398897 | 25/57 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152217 | |
Domainoid | 1 | 1.000 | 79 | 1.000 | Domainoid score | I8666 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3500 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 82 | 1.000 | Inparanoid score | I5197 |
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2878 |
OMA | 1 | 1.010 | - | - | QHG49180 | |
OrthoDB | 1 | 1.010 | - | - | D1613627at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001872 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8530 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_102348 | |
Panther | 1 | 1.100 | - | - | O | PTHR12263 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2893 |
SonicParanoid | 1 | 1.000 | - | - | X1797 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
15 | 14.790 |