DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-c and atp6v0e1

DIOPT Version :9

Sequence 1:NP_647868.1 Gene:VhaM9.7-c / 38503 FlyBaseID:FBgn0028664 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001165157.1 Gene:atp6v0e1 / 100216036 XenbaseID:XB-GENE-988748 Length:81 Species:Xenopus tropicalis


Alignment Length:71 Identity:26/71 - (36%)
Similarity:39/71 - (54%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVFFTIFWAAVAKYGPILFTKQPHDDLVRCIFLLTAVVCWLFWLCCYLAQLNPLLGPKLNGNTIR 71
            |:..|:||..:....|....|.|:..::..:.:..:|.|:||||...|||||||.||:|...||.
 Frog    10 IIVMTVFWGFIGAILPWFIPKGPNRGVINTMLVTCSVCCYLFWLIAILAQLNPLFGPQLTSETIY 74

  Fly    72 IIASSW 77
            .:.:.|
 Frog    75 YLKNHW 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-cNP_647868.1 ATP_synt_H 6..64 CDD:283211 21/56 (38%)
atp6v0e1NP_001165157.1 ATP_synt_H 9..67 CDD:368469 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10066
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - otm47853
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.