DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Teh2 and Teh1

DIOPT Version :9

Sequence 1:NP_001163345.1 Gene:Teh2 / 38502 FlyBaseID:FBgn0035505 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_001262442.1 Gene:Teh1 / 41215 FlyBaseID:FBgn0037766 Length:299 Species:Drosophila melanogaster


Alignment Length:211 Identity:77/211 - (36%)
Similarity:108/211 - (51%) Gaps:17/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EKAKFYTSVCLGTTAILSVFTFLFLIPFVVDPAISTIIADYDPVPVTCIVIDHIYAEGIKNCSWS 146
            |:|:||.:..|...::.:..:.|||:|..|||||||:..|:...|..|.........||.|||||
  Fly    41 ERARFYGTSTLAFFSVTAGASLLFLVPLYVDPAISTLSHDFIEKPTLCTTTRREDLVGIFNCSWS 105

  Fly   147 SCREGCTSSLTKCHQLFVNYTR----IPFSEWERNPRDLDTVNWDVSYT---KFLINSEGCGYPP 204
            ||||||||.|.:|..::|.:..    ||     .|..|......|:..:   ..|:|.:||||||
  Fly   106 SCREGCTSDLYRCVHIYVTFIEQNITIP-----ENMTDYSNFTSDMEQSGEATLLVNIKGCGYPP 165

  Fly   205 TTNCSIFARQYGFSHIGEPFPCFYSRAYPEVVIGRYSWENNLYHLILSLIIPNVLFAISIGVLSY 269
            :..|..|...||..  |..|||||||....||:..|:.::.:..:|....:|.|:..||...|..
  Fly   166 SVTCKNFNGYYGIE--GAIFPCFYSRKNKTVVLTSYNHDDQVAMIIHFFAVPFVITVISSIALCI 228

  Fly   270 WYCPC-CEKACNKSSR 284
            .:|.| |:|  ::|.|
  Fly   229 MHCDCRCKK--DRSHR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Teh2NP_001163345.1 TipE 73..>271 CDD:293577 71/195 (36%)
Teh1NP_001262442.1 TipE 37..>221 CDD:293577 68/186 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJ08
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110143at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.