Sequence 1: | NP_001163345.1 | Gene: | Teh2 / 38502 | FlyBaseID: | FBgn0035505 | Length: | 313 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_647866.2 | Gene: | Teh4 / 38501 | FlyBaseID: | FBgn0035504 | Length: | 524 | Species: | Drosophila melanogaster |
Alignment Length: | 395 | Identity: | 64/395 - (16%) |
---|---|---|---|
Similarity: | 101/395 - (25%) | Gaps: | 218/395 - (55%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 EKAKFYTSVCL-GTTAILSVFTFLFLIPFVVDPAISTIIADYDPVPVTCIVIDHIYAEGIKNCSW 145
Fly 146 SSCREGC---------------------------------------TSSLTK------------- 158
Fly 159 ------------------CHQ----LFVN------------------YTRI-------------- 169
Fly 170 --------------------------------------PFSEWERNPRDL--------------- 181
Fly 182 ---DTVN-------------------WDV------------------------SYTKFLINSEGC 200
Fly 201 GYPPTTNCSIFARQYGFSHIGE------PFPCFYSR-AYPEVVIGRYSWENNLYHLILSLIIPNV 258
Fly 259 LFAIS 263 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Teh2 | NP_001163345.1 | TipE | 73..>271 | CDD:293577 | 64/395 (16%) |
Teh4 | NP_647866.2 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45469578 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12335 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |