DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Teh4 and Teh2

DIOPT Version :9

Sequence 1:NP_647866.2 Gene:Teh4 / 38501 FlyBaseID:FBgn0035504 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001163345.1 Gene:Teh2 / 38502 FlyBaseID:FBgn0035505 Length:313 Species:Drosophila melanogaster


Alignment Length:395 Identity:64/395 - (16%)
Similarity:101/395 - (25%) Gaps:218/395 - (55%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QDARICRAICLCQLTMVLSCVSIVYLSVAIYSPSLKAFKSGFELDPVMCQTVDR---QMPNNCPW 75
            :.|:...::|| ..|.:||..:.::|...:..|::....:.::..||.|..:|.   :...||.|
  Fly    82 EKAKFYTSVCL-GTTAILSVFTFLFLIPFVVDPAISTIIADYDPVPVTCIVIDHIYAEGIKNCSW 145

  Fly    76 ASCGEWCLTKTSGFCPQIHSIVRRNGTDIQLNNCTRVTNTSCAMIDLSRLNKFNCNNGTACNNIR 140
            :||.|.|                                       .|.|.|             
  Fly   146 SSCREGC---------------------------------------TSSLTK------------- 158

  Fly   141 GVFNCSNGHCKNMSEFFLCHHKADGLTVNSQKDNTKLNGFFECHGVHCTKIKKPFSCDRYCSKIT 205
                              ||.    |.||                  .|:|              
  Fly   159 ------------------CHQ----LFVN------------------YTRI-------------- 169

  Fly   206 TTNVNTLIMHEDNLIAADCENAVAFNQARGSEHGVRIEPFEFWKEDDGNLLTNCATVTRESDNRI 270
                                                  ||..|:.:..:|               
  Fly   170 --------------------------------------PFSEWERNPRDL--------------- 181

  Fly   271 TATDCINGTLLEHDTLPAPFMNFTQFWAIYENSTRSVDPEQRYLPNQANLTIYSWKKLFINLEGC 335
               |.:|                   |.:                        |:.|..||.|||
  Fly   182 ---DTVN-------------------WDV------------------------SYTKFLINSEGC 200

  Fly   336 VNTLRGECKDFVARYG--NDGDNNTAQSRYQCYYNKDSNVEFVVARYDLDKVYRELLVSLIVPIV 398
            .......|..|..:||  :.|:      .:.|:|:: :..|.|:.||..:.....|::|||:|.|
  Fly   201 GYPPTTNCSIFARQYGFSHIGE------PFPCFYSR-AYPEVVIGRYSWENNLYHLILSLIIPNV 258

  Fly   399 LFVIS 403
            ||.||
  Fly   259 LFAIS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Teh4NP_647866.2 None
Teh2NP_001163345.1 TipE 73..>271 CDD:293577 64/395 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.