DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and CG11668

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:313 Identity:80/313 - (25%)
Similarity:134/313 - (42%) Gaps:65/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   763 RSYH-------NHQAQADQPDLVYP---EYYQQRSLYGLQSNFSGRRRARVVGGEDGENGEWCWQ 817
            |::|       |...:.||.:||.|   ::.|.::|              :|||...:..|..:.
  Fly   112 RAHHKRRRRRRNTNPKLDQVELVEPIIQKHNQSQNL--------------LVGGRLTQENEHPYM 162

  Fly   818 VAL--INSLNQYL-------------CGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLTR 867
            .||  .:..|:::             ||.|:|..::.:|||||.:  |.........:|..:|..
  Fly   163 CALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCAS--VGGESPSVALIGGVELNS 225

  Fly   868 KYGSPGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCL---VCLPARGVSHAAGKR 929
            ..|    |.:.:.....|.:.:::||.||:|::||..::.: ...||   ..||.|.:       
  Fly   226 GRG----QLIEIKRISQHPHFDAETLTNDLAVVKLARRSHM-PVACLWNQESLPERPL------- 278

  Fly   930 CTVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGGEEGH-DACQG 993
             |..|||....|||....:.:..:..::..:|.|.::...:....|.:...|||...|: |.|||
  Fly   279 -TALGYGQTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGLGSGQMCAGDYSGNMDTCQG 342

  Fly   994 DGGGPLVCQDDGFYE------LAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQ 1040
            |.||||:......:.      :.|:.|:|..|. ...|||||:.:.:|.||.|
  Fly   343 DSGGPLLLHQHMRHHRHTIPYVVGITSFGGACA-SGQPGVYVRIAHYIQWIEQ 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 70/263 (27%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 70/262 (27%)
Tryp_SPc 149..392 CDD:214473 67/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.