DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and CG10041

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_650177.2 Gene:CG10041 / 41496 FlyBaseID:FBgn0038014 Length:287 Species:Drosophila melanogaster


Alignment Length:243 Identity:59/243 - (24%)
Similarity:105/243 - (43%) Gaps:46/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   809 GENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCV-TNIVRSGDAIYVRVGDYDL-TRKYGS 871
            |||         :....::||...::..::||:||||: ||..:.   :||..|...| :||   
  Fly    57 GEN---------LKGYYKHLCVGVILSNEFVLSAAHCIQTNPTKQ---LYVAGGADSLNSRK--- 106

  Fly   872 PGAQTLRVATTYIHHNHNSQTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHA------AGKRC 930
               ||.........|........||||:|:::.:..|.|      :..|.::.|      :|.:.
  Fly   107 ---QTRFFVVERRWHPQFRVLGGNDIAVLRIYPKFPLDD------VRFRSINFAGKPQRDSGTQA 162

  Fly   931 TVTGYGYMGEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGGEEG-HDACQGD 994
            ::.|:|.:| .|.| .:::|.....:.:.||.:     :.:...|.....||...:| ...|.||
  Fly   163 SLVGWGRVG-VGKI-RKLQEMPFLTMENDECQQ-----SHRFVFLKPLDICAMHLKGPRGPCDGD 220

  Fly   995 GGGPL--VCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQ 1040
            .|.||  |.::    :|.||:|:|........|..:.:.:::..||.:
  Fly   221 SGAPLMNVAKE----KLYGLLSYGRKACTPLKPYAFTRINAYSSWIQE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 59/243 (24%)
CG10041NP_650177.2 Tryp_SPc 49..264 CDD:238113 59/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.