DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mas and CG32277

DIOPT Version :9

Sequence 1:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:255 Identity:74/255 - (29%)
Similarity:122/255 - (47%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   799 RRARVVGGEDGENGEWCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDY 863
            |:.::.||:.....:..:.|.|... .::.||..:|....|||||||:       :..|.:|.|.
  Fly    23 RQGKIFGGKTTLVKDHSFLVNLRRG-GKFRCGGVIISPNCVLTAAHCL-------EGRYQQVRDL 79

  Fly   864 DLTRKYGSPG----AQTLRVATTYIHHNHN---SQTLDNDIALLKLHGQAELRDGVCLVCLPARG 921
            .:..:....|    .:.:|.| .|:..:.|   .:.||:|:|:::|....::.....||.:....
  Fly    80 TVHAQQQCLGDDMPPEHVRSA-WYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAGNASLVKIDYND 143

  Fly   922 V-SHAAGKRCTVTGYGYMGEAGPIPLR-VREAEIPIVSDTECIRKVNAVTEKIFILPASSFCAGG 984
            : .|:   ..||.|:|.:.|.|....: ::||.:.::|..|||:.|.:..:|:   ..:.|||.|
  Fly   144 LPPHS---NLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKV---TNNMFCALG 202

  Fly   985 EEGHDACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTS--SFIGWINQII 1042
            :...||||||.|||.:...    ...|:||||:||| ...||||.:.|  |...|:...|
  Fly   203 KNARDACQGDSGGPAIYAG----RSVGIVSWGYGCG-SGYPGVYTRLSSPSITYWLKDFI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 72/248 (29%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 69/239 (29%)
Tryp_SPc 27..246 CDD:238113 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.